The short version of HPLC fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-09-10 and is reviewed periodically as new material appears.
Reconstitution introduces new risks because the peptide contacts solvent, air, and container surfaces. The chosen solvent should match the peptide's solubility profile, and buffer salts, pH, and ionic strength can affect dissolution and subsequent stability. Gentle mixing is preferred over vigorous vortexing, which can create interfaces and shear. If the solution is not clear, the cause may be incomplete dissolution, aggregation, or insoluble counter-ions rather than a simple concentration problem. Filtration is sometimes used, but filters can adsorb peptides and alter measured concentration.
Cold-chain practice relies on documented temperature ranges, calibrated monitoring, and minimized excursions. Shipments may use insulated boxes, phase-change materials, or dry ice, with data loggers to record conditions. Upon receipt, the recipient should verify the logger trace and place items into long-term storage promptly. Repeated warming and cooling during transfers can be more harmful than a single controlled excursion. For solutions, dividing material into single-use aliquots reduces the number of thawing and refreezing events and limits repeated opening of the same container.
Handling begins before a peptide arrives at the bench. Containers should be inspected for cracks, loose caps, or visible moisture, and labels should record identity, lot, and receipt date. Lyophilized material is often allowed to equilibrate to room temperature before opening to prevent condensation on the powder. Gloves and a clean workspace reduce contamination and static-related loss. Once opened, the vial may be purged with inert gas and resealed if the peptide is sensitive to oxygen or humidity. These steps are procedural safeguards rather than guarantees of stability.
Cold-chain shipping uses insulated containers, phase-change packs, and temperature indicators. Dry ice maintains -70 °C or lower but requires venting to avoid pressure buildup. Gel packs provide 2-8 °C for shorter transit. Upon arrival, recipients should record temperature indicators and transfer vials promptly to storage. Deviations from specified conditions should be documented and may require analytical re-check. The effect of a brief temperature excursion is peptide-specific and not always predictable from general rules.
Handling begins with receipt and inspection. Vials should be checked for damage, label integrity, and temperature history. Lyophilized peptides should be allowed to equilibrate to room temperature before opening to prevent condensation. Solutions should be prepared in a clean, calibrated environment using appropriate solvents. Personal protective equipment and containment reduce exposure and contamination. Documentation of lot number, date, and storage location supports traceability. The goal is to limit repeated temperature changes, moisture exposure, and microbial contamination.
| Property | Value | Notes |
|---|---|---|
| Container material | Glass or polypropylene | Low-binding options reduce peptide adsorption |
| Typical shipping condition | Dry ice or gel packs | Choice depends on required temperature range |
| Light protection | Amber vial or foil wrap | Reduces photodegradation of sensitive residues |
| Reconstitution solvent | Water, buffer, or organic co-solvent | Depends on peptide solubility and assay requirements |
| Temperature monitoring | Data logger or indicator | Documents excursions during transport and storage |
Temperature logs and cold-chain documentation help identify excursions that may compromise a batch. Automated freezers, desiccant packs, and sealed containers limit moisture and frost accumulation. Aliquoting small portions before freezing reduces the number of times the main stock changes temperature. Labels should include peptide name, lot, concentration if known, solvent, and date prepared. Periodic analytical verification by high-performance liquid chromatography or mass spectrometry can detect degradation, truncation, or sequence errors that visual inspection cannot reveal.
Practical handling begins with an inventory record that links each vial to a lot number, synthesis date, and purity certificate. Before opening a container, allow it to equilibrate to room temperature to prevent condensation on the powder. Weighing or transferring should occur in a low-humidity environment using tools that minimize static and adsorption. Hygroscopic peptides may gain water quickly, changing mass and concentration estimates. Recording the container's initial mass and any visible changes supports later reconciliation of material.
Quality control links handling to measurable identity and purity. Reverse-phase high-performance liquid chromatography can separate peptide variants and reveal impurities. Mass spectrometry confirms molecular mass and can detect truncations or modifications. These methods are often paired with ultraviolet absorbance or amino acid analysis for concentration. Documentation of instrument settings, column type, and reference standards supports reproducibility. For research materials, acceptance criteria depend on the intended application, and no universal purity threshold applies to all peptides.
Handling begins when a peptide container is opened. Hygroscopic solids can absorb atmospheric water rapidly, so bench work should be brief and containers resealed with fresh desiccant. Weighing or transferring should occur in a low-humidity environment where possible. Static electricity may cause fine powders to cling to surfaces, leading to inaccurate mass measurements. Tools such as antistatic devices or grounded workstations reduce that problem. Good laboratory practice also includes labeling date, lot, and storage condition after each opening.
Reconstitution introduces new variables. The solvent should match the peptide's solubility profile, and water or buffer quality matters because trace metals and microbes can alter results. Adding solvent gently down the vial wall minimizes foaming, which can denature some sequences. Mixing by gentle inversion or swirling is usually preferred over vigorous vortexing. If a peptide does not dissolve readily, adjusting pH or using a small amount of organic co-solvent may help, but such steps can also affect stability and should be documented.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Molecular biomarkers have been defined as biomarkers that can be discovered using basic and acceptable platforms such as genomics and proteomics. Many genomic and proteomics techniques are available for biomarker discovery and a few techniques that are recently being used can be found on that page. Apart from genomics and proteomics platforms biomarker assay techniques, metabolomics, lipidomics, glycomics, and secretomics are the most commonly used as techniques in identification of biomarkers. Biomarkers can be classified on their clinical applications as molecular biomarkers, cellular biomarkers or imaging biomarkers. Four of the main types of molecular biomarkers are genomic biomarkers, transcriptomic biomarkers, proteomic biomarkers and metabolic biomarkers.
Autosomal-dominant mutations in APP cause hereditary early-onset Alzheimer's disease (familial AD, fAD). This form of AD accounts for no more than 10% of all cases, and the vast majority of AD is not accompanied by such mutations. However, familial Alzheimer's disease is likely to result from altered proteolytic processing. This is evidenced by the fact that many mutations that lead to fAD occur near γ-secretase cleavage sites on APP. One of the most common mutations causing fAD, London Mutation, occurs at codon 717 of the APP gene, and results in a valine to isoleucine amino acid substitution. Histochemical analysis of the APP V717I mutation has revealed extensive Aβ pathology throughout neuroaxis as well as widespread cerebral amyloid angiopathy (CAA). The gene for the amyloid precursor protein is located on chromosome 21, and accordingly people with Down syndrome have a very high incidence of Alzheimer's disease.
Apitegromab, sold under the brand name Isembyld, is a fully human IgG4 lambda monoclonal antibody used for the treatment of spinal muscular atrophy. It is a recombinant monoclonal antibody targeting proforms of myostatin. The most common side effects include upper respiratory tract infections, vomiting, cough, other viral infections, headache, gastroenteritis, and pharyngitis (sore throat). Apitegromab was approved for to treat Spinal Muscular Atrophy in the United States in September 2026. Apitegromab is indicated for the treatment of spinal muscular atrophy in people aged two years of age and older who are currently receiving a survival motor neuron 2-targeted treatment.Spinal muscular atrophy is a rare, progressive neuromuscular disease affecting approximately 1 in 10,000 live births and is among the leading genetic causes of infant mortality. It is caused by a faulty survival motor neuron 1 (SMN1) gene that fails to produce a protein essential for motor neuron survival, leading to progressive muscle weakness and wasting.
The Analytical Information Markup Language (AnIML) is an open ASTM XML standard for storing and sharing analytical chemistry and biological data. A main reason of using AnIML is that FAIR data (Findable, Accessible, Interoperable and Reusable) standards are automatically implemented. As AnIML's structure is human-readable, Accessibility is given. Interoperability, Reusability and Findability are secured by the AnIML Core and AnIML Technique Definitions. AnIML has been continuously worked on starting from 2003 up to 2020. The last AnIML Core Version update happened in 2010. So far, no standardisation document nor public example files have been published. The standard exists only in pre-release form. AnIML is a XML standard which consists of two logical layers:
Sources: en.wikipedia.org
The period from 1958 to 1968 saw tremendous growth in aviation. Improvements in aviation safety and accident investigation procedures were rapidly advancing. In 1963, the Civil Aeronautics Board, under the leadership of then Deputy Director Bobbie R. Allen, established the National Aircraft Accident Investigation School in Oklahoma City. The ICAO's third accident investigation division meeting, held in Montreal, Canada, in January 1965, laid the foundation for accident investigations throughout the world. The proposals were presented by the Director of the Civil Aeronautics Board Bureau of Safety, Bobbie R. Allen, who headed the U.S. delegation. The U.S. formally adopted the proposals at the White House on December 1, 1965. The top 10 countries with the highest number of fatal civil airliner accidents from 1945 to 2021 are the United States, Russia, Canada, Brazil, Colombia, United Kingdom, France, Indonesia, Mexico, and India. The United Kingdom is noted to have the highest number of air crashes in Europe, with a total of 110 air crashes within the time period, and Indonesia is the highest in Asia at 104, followed by India at 95.
The carbohydrate-insulin model (CIM) posits that obesity is caused by excess consumption of carbohydrate, which then disrupts normal insulin metabolism leading to weight gain and weight-related illnesses. It is contrasted with the mainstream energy balance model (EBM), which holds that obesity is caused by an excess in calorie consumption compared to calorie expenditure. According to the carbohydrate–insulin model, low-carbohydrate diets would be the most effective in causing long-term weight loss. Notable proponents of the carbohydrate–insulin model include Gary Taubes and David Ludwig. The CIM has been tested in mice and humans. Although some experts consider that these studies falsified the CIM, proponents disagree. Available evidence does not support the existence of a long-term advantage in weight loss for low-carbohydrate diets.
Various signalling pathways, as FGF, WNT and TGF-β pathways, regulate the processes involved in embryogenesis. FGF (Fibroblast Growth Factor) ligands bind to receptors tyrosine kinase, FGFR (Fibroblast Growth Factor Receptors), and form a stable complex with co-receptors HSPG (Heparan Sulphate Proteoglycans) that will promote autophosphorylation of the intracellular domain of FGFR and consequent activation of four main pathways: MAPK/ERK, PI3K, PLCγ and JAK/STAT.
In March 2008, AFRL's Human Effectiveness Directorate located at Wright-Patterson AFB was merged with the Air Force School of Aerospace Medicine and the Human Performance Integration Directorate from the 311th Human Systems Wing both located at Brooks City-Base, Texas to form the 711th Human Performance Wing. In its vision statement, the wing includes the goals of improving aerospace medicine, science and technology, and human systems integration. The current Commander of the 711th is Brig. Gen. Timothy Jex. One practical application of its work is ensuring and advancing the safety of ejection systems for pilots. With the increasing number of females in the Air Force ranks, anthropometry is of greater import now than ever, and 711th's WB4 'whole-body scanner' enables swift and accurate acquisition of anthropometric data which may be used to design pilot equipment with a better fit for comfort and safety.
8 October – Tánaiste Micheál Martin said that the Department of Foreign Affairs had been in touch with the family of Kim Damti (22), an Irish-Israeli woman who was unaccounted for following the previous day's series of attacks launched by Hamas on Israel. On 11 October, Damti was confirmed dead. 10 October – Minister for Finance Michael McGrath and Minister for Public Expenditure, National Development Plan Delivery and Reform Paschal Donohoe announced Budget 2024, with three electricity credits for all households, a €12 increase to core social welfare payments and half-price travel for those aged under 25. 23 October – Yousef Palani was sentenced to two life sentences plus 20 years for the murder of two men and the stabbing of a third in Sligo, all of who he had sought out on a pretence of dating. 25 October – The Health Products Regulatory Authority (HPRA) said it had seized 254 units of falsified Semaglutide, a drug used for type 2 diabetes and as an unofficial aide to weight loss, during 2023. 27 October – Latest figures showed that homelessness in Ireland hit new records: 8,923 adults and 3,904 children accessed emergency accommodation in September 2023, bringing the total to 12,827 people.
Sources: en.wikipedia.org
Allow the sealed vial to reach room temperature before opening to reduce condensation. Use a suitable solvent and gentle mixing rather than vigorous agitation. Follow the supplier's solubility information when available.
Aliquots limit repeated thawing and refreezing and repeated vial opening, both of which can promote degradation. They also reduce the chance of contaminating an entire batch. Single-use portions should be labeled with identity, concentration, solvent, and date.
Inspect the package for damage and confirm that temperature indicators or data loggers stayed within the specified range. Check the vial condition and labeling before placing it into storage. Record any excursion or discrepancy for the supplier or quality system.
No. Allowing the sealed vial to equilibrate to room temperature reduces condensation on the powder. Condensation can introduce moisture and promote degradation. Equilibration usually takes 15 to 30 minutes depending on vial size.