A practical reference on aliquoting: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-11-06 and is reviewed periodically as new material appears.
Aliquoting reduces repeated temperature cycling for solutions and reconstituted samples. If a peptide is supplied as a powder, reconstitution usually involves adding a suitable solvent gently along the vial wall. Mixing by inversion or slow swirling is preferred over vortexing, which can create air-liquid interfaces that promote aggregation or foaming. The resulting solution should be inspected for clarity, particles, and color before storage. Labels on aliquots typically include concentration, solvent, date, and lot number, and open questions remain about the best solvent for every sequence.
Quality control relies on analytical methods that detect changes in purity, identity, and concentration. Reverse-phase high-performance liquid chromatography separates the parent peptide from degradation products, while mass spectrometry confirms molecular mass. Water content can be measured by Karl Fischer titration, and amino acid analysis or peptide mapping may reveal sequence-level modifications. Stability studies compare stored samples against baseline material at defined intervals. Documentation should link each result to a lot number, storage condition, and test date so that trends can be reviewed.
Receipt and inventory practices begin with inspection of packaging, temperature indicators, and lot-specific documentation. A certificate of analysis typically reports purity, identity, and sometimes residual water or counterion content. Containers should be labeled with the peptide name, lot number, date received, and storage location. Before a sealed vial is opened, it is often equilibrated to room temperature to reduce condensation on the contents. Clean tools, gloves, and a designated workspace limit contamination and accidental adsorption losses.
Handling begins when a peptide container is opened. Hygroscopic solids can absorb atmospheric water rapidly, so bench work should be brief and containers resealed with fresh desiccant. Weighing or transferring should occur in a low-humidity environment where possible. Static electricity may cause fine powders to cling to surfaces, leading to inaccurate mass measurements. Tools such as antistatic devices or grounded workstations reduce that problem. Good laboratory practice also includes labeling date, lot, and storage condition after each opening.
Reconstitution introduces new variables. The solvent should match the peptide's solubility profile, and water or buffer quality matters because trace metals and microbes can alter results. Adding solvent gently down the vial wall minimizes foaming, which can denature some sequences. Mixing by gentle inversion or swirling is usually preferred over vigorous vortexing. If a peptide does not dissolve readily, adjusting pH or using a small amount of organic co-solvent may help, but such steps can also affect stability and should be documented.
Quality control links handling to measurable identity and purity. Reverse-phase high-performance liquid chromatography can separate peptide variants and reveal impurities. Mass spectrometry confirms molecular mass and can detect truncations or modifications. These methods are often paired with ultraviolet absorbance or amino acid analysis for concentration. Documentation of instrument settings, column type, and reference standards supports reproducibility. For research materials, acceptance criteria depend on the intended application, and no universal purity threshold applies to all peptides.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Peptide, oligopeptide, polypeptide | Usage varies; polypeptide often implies a longer chain |
| Purity assessment | High-performance liquid chromatography | Often reversed-phase; reported as area percent with method and wavelength stated |
| Identity confirmation | Mass spectrometry | Observed mass compared with theoretical mass within instrument tolerance |
| Water content (lyophilized) | Karl Fischer titration | Residual moisture can affect stability and weighing accuracy |
| Container compatibility | Low-binding polypropylene | Glass may adsorb some peptides; plastic additives can leach |
Reconstitution involves adding a solvent to dry peptide, often water or a buffered solution. The chosen liquid should match the peptide's solubility and intended assay, and it should be free of contaminants. Gentle mixing or inversion reduces foaming and shear, which can damage some peptides. If the peptide does not dissolve readily, adjusting pH or using a small amount of organic co-solvent may help. The final solution is typically clarified before use in analytical or laboratory procedures.
After reconstitution, solutions are usually divided into single-use aliquots to limit repeated handling. Each aliquot is stored at a temperature appropriate for the peptide, with -20 °C or -80 °C common for longer-term laboratory storage. Freeze-thaw cycles are minimized because they can cause aggregation, precipitation, or loss of activity. Temperature monitoring and documented storage conditions support reproducibility across experiments. When a peptide is removed from storage, it is typically allowed to equilibrate before opening to reduce condensation.
Receiving a peptide begins with recording its identity, lot number, quantity, and arrival condition. Dry material is often kept in sealed containers with desiccant and an inert headspace to limit moisture and oxygen. Containers should be compatible with the peptide and solvent; some peptides adsorb to certain plastics or glass. Labels should include date, concentration, solvent, and storage location. A centralized inventory with temperature logs helps prevent loss and mix-ups.
Temperature logs and cold-chain documentation help identify excursions that may compromise a batch. Automated freezers, desiccant packs, and sealed containers limit moisture and frost accumulation. Aliquoting small portions before freezing reduces the number of times the main stock changes temperature. Labels should include peptide name, lot, concentration if known, solvent, and date prepared. Periodic analytical verification by high-performance liquid chromatography or mass spectrometry can detect degradation, truncation, or sequence errors that visual inspection cannot reveal.
Practical handling begins with an inventory record that links each vial to a lot number, synthesis date, and purity certificate. Before opening a container, allow it to equilibrate to room temperature to prevent condensation on the powder. Weighing or transferring should occur in a low-humidity environment using tools that minimize static and adsorption. Hygroscopic peptides may gain water quickly, changing mass and concentration estimates. Recording the container's initial mass and any visible changes supports later reconciliation of material.
Reconstitution introduces additional variables: solvent choice, pH, ionic strength, and filtration. Many sequences dissolve readily in water, while hydrophobic ones may need acetonitrile, dimethyl sulfoxide, or a small amount of base. Adding solvent slowly and avoiding vigorous vortexing can reduce foaming and shear-induced aggregation. If the solution appears cloudy, filtration may remove particulates but can also remove aggregated peptide and alter concentration. A clear solution does not by itself confirm correct sequence or purity, so analytical checks remain necessary.
Reconstitution is the process of dissolving a dried peptide in a suitable solvent. The choice of solvent depends on solubility, charge, and sequence; sterile water is common, while buffers or small amounts of organic solvent may be needed for hydrophobic peptides. Adding solvent gently down the vial wall and mixing by inversion or gentle swirling reduces foaming and shear. Vortexing or vigorous pipetting can denature some peptides or promote aggregation. The resulting solution should be visually inspected for particles, turbidity, and complete dissolution before use.
After reconstitution, solutions are usually divided into single-use aliquots to avoid repeated freeze-thaw cycles. Aliquots should be labeled with peptide identity, concentration, solvent, and date, then stored at the temperature specified by the supplier or protocol. Many peptides tolerate -20 °C for short periods, while -80 °C is preferred for longer storage. Frost-free freezers are generally avoided because temperature fluctuations can stress samples. Aseptic technique and sterile filters reduce microbial contamination, though filtration can also remove aggregated material or bind some peptides.
On 1 December 1978, the Health and Safety Executive announced their intention to prosecute the university for breach of safety legislation. The case was heard in October 1979 at Birmingham Magistrates' Court. Although the source of infection was traced, the mode and cause of transmission was not. Evidence presented by several internationally recognised experts, including Kevin McCarthy, Allan Watt Downie and Keith R. Dumbell, showed that airborne transmission from the laboratory to the telephone room where Parker was supposedly infected was highly improbable. The experts calculated that it would require 53,700 litres (11,812 imp gal) of virus fluid to have been aspirated (meaning, in this context, removed by suction of fluid and cells through a needle) and it would take 20,000 years for one particle to travel to the telephone room at the rate the fluid was aspirated. It was additionally found that although the Shooter Inquiry noted the poor state of the duct sealing in the laboratory, this was caused after the outbreak by engineers fumigating the laboratory and ducts. The university was found not guilty of causing Parker's death.
An alpha helix (or α-helix) is a sequence of amino acids in a protein that are twisted into a coil (a helix). The alpha helix is the most common structural arrangement in the secondary structure of proteins. It is also the most extreme type of local structure, and it is the local structure that is most easily predicted from a sequence of amino acids. The alpha helix has a right-handed helix conformation in which every backbone N−H group hydrogen bonds to the backbone C=O group of the amino acid that is four residues earlier in the protein sequence. The alpha helix is also commonly called a: Pauling–Corey–Branson α-helix (from the names of three scientists who described its structure) 3.613-helix because there are 3.6 amino acids in one ring, with 13 atoms being involved in the ring formed by the hydrogen bond (starting with amidic hydrogen and ending with carbonyl oxygen)
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Klibanski became chief of the Neuroendocrine Unit at Massachusetts General Hospital, studying hormones and neuroendocrinology with a focus on hypopituitarism and pituitary tumors. Her clinical research has also examined the effects of hypothalamic and pituitary disorders on body composition and bone density, including bone loss associated with anorexia nervosa and growth hormone deficiency. In 1997, Klibanski became the first woman from Mass General's Department of Medicine to become a professor of medicine at Harvard. She has authored more than 350 peer-reviewed papers and book chapters and has received the Endocrine Society Clinical Investigator Award and the Clinical Endocrinology Trust Medal from the Society for Endocrinology. Klibanski has served on the National Institute of Diabetes and Digestive and Kidney Diseases Board of Counselors and the editorial board of the Journal of Clinical Endocrinology and Metabolism, and is a past president of the Pituitary Society. She established the Center for Faculty Development at Massachusetts General Hospital and mentored more than fifty women, for which she received the Endocrine Society's Outstanding Mentor Award.
In the most common means for its production, cells make 5-oxo-ETE in a four step pathway that involves their stimulus-induced activation of the following pathway: a) the release of arachidonic acid (i.e. 5Z,8Z,11Z,14Z-eicosatetraenoic acid) from its storage sites in membrane phospholipids due to the activation of phospholipase A2 enzymes; b) oxygenation of this arachidonic acid by activated arachidonate 5-lipoxygenase (ALOX5) to form 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HpETE); c) reduction of this 5(S)-HpETE by ubiquitous cellular peroxidases to form 5(S)-hydroxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HETE); and (d) the oxidation of 5(S)-HETE by a microsome-bound nicotinamide adenine dinucleotide phosphate (NADP+)-dependent dehydrogenase enzyme viz., 5-hydroxyeicosanoid dehydrogenase (5-HEDH), to form 5-oxo-ETE:
In the UK, a House of Commons Select Committee on Environment, Food and Rural Affairs report on the horse meat incident was not critical of UK or Irish producers. It expressed concern that horsemeat contamination resulted from fraud and other criminal activity across the EU. Chair of the Committee, Anne McIntosh MP, said: "The evidence suggests a complex network of companies trading in and mislabelling beef or beef products which is fraudulent and illegal." The second major UK report on the horse meat incident was conducted by Professor Chris Elliott, the Director of the Institute for Global Food Security at Queen's University Belfast. In his independent report, he argues that food crime was at the heart of the horsemeat incident and makes a range of suggestions for how this could be tackled. "Industry, government and enforcement agencies should, as a precautionary principle, always put the needs of consumers above all other considerations, and this means giving food safety and food crime prevention—i.e. the deterrence of dishonest behaviour—absolute priority over other objectives."
In collaboration with the Academic Medical Center in Amsterdam, Inreda Diabetic B.V. has developed a closed loop system with insulin and glucagon. The initiator, Robin Koops, started to develop the device in 2004 and ran the first tests on himself. In October 2016 Inreda Diabetic B.V. got the ISO 13485 license, a first requirement to produce its artificial pancreas. The product itself is called Inreda AP, and soon made some highly successful trials. After clinical trials, it received the CE marking, noting that it complies with European regulation, in February 2020. In October 2020 the health insurance company Menzis and Inreda Diabetic then started a pilot with 100 patients insured by Menzis. These are all patients that face very serious trouble in regulating their blood glucose levels. They now use the Inreda AP instead of the traditional treatment. Another large scale trial with the Inreda AP was set up in July 2021, and should determine whether Dutch health insurance should cover the device for all their insured. A smaller improved version of the Inreda AP is scheduled for release in 2023.
Sources: en.wikipedia.org
Allow the sealed vial to equilibrate to room temperature so condensation does not form on the powder or solution. Wipe the exterior with a suitable disinfectant if the workspace requires it. Open the vial in a clean, draft-free area to reduce contamination.
Vortexing creates rapid air-liquid interfaces that can cause foaming and promote aggregation. Gentle inversion or slow swirling usually dissolves the peptide with less physical stress. Some sequences tolerate vortexing, but minimizing shear is a general precaution.
A certificate of analysis usually reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes water content or counterion. It may also list lot number, storage recommendations, and handling notes. Exact content varies by supplier and product type.
Aliquoting divides a stock into portions that can be thawed once and used without returning the whole batch to storage. This limits temperature cycling and reduces the chance of contamination or concentration changes. It also makes it easier to track how many portions remain.